RegulonDB RegulonDB 11.2: Gene Form
   

ompC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ompC ftp micF Lrp Lrp AcrR Lrp SoxS Rob MarA Lrp IHF CpxR SoxS CpxR OmpR OmpR YjjQ OmpR Lrp Lrp Lrp Lrp Lrp Lrp Ada MalH anti-anti-terminator anti-terminator terminator micFp2 micFp2 micFp1 micFp1 ompCp3 ompCp3 ompCp2 ompCp2 ompCp1 ompCp1 TSS_2488 TSS_2488 TSS_2487 TSS_2487 TSS_2486 TSS_2486 TSS_2485 TSS_2485 TSS_2484 TSS_2484 apbEp1 apbEp1

Gene      
Name: ompC    Texpresso search in the literature
Synonym(s): ECK2207, EG10670, b2215, meoA, par
Genome position(nucleotides): 2311646 <-- 2312749
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
 50.63


Product      
Name: outer membrane porin C
Synonym(s): MeoA, OmpC, Par, outer membrane protein 0-8, outer membrane protein 4, outer membrane protein A2, outer membrane protein Ib
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 40.368
Isoelectric point: 4.38
Motif(s):
 
Type Positions Sequence Comment
1 -> 21 MKVKVLSLLVPALLVAGAANA
22 -> 367 AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF UniProt: Outer membrane porin C.
27 -> 367 KDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF
34 -> 42 LYGKVDGLH UniProt: Beta stranded.
54 -> 63 QTYMRLGFKG UniProt: Beta stranded.

 
Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.1 - Channel-type Transporters --> 4.1.B - Beta barrel porins (The Outer Membrane Porin (OMP) Functional Superfamily)
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
GO:0045203 - integral component of cell outer membrane
GO:0046930 - pore complex
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0015288 - porin activity
GO:0042802 - identical protein binding
GO:0001618 - virus receptor activity
biological_process GO:0120010 - intermembrane phospholipid transfer
GO:0006811 - ion transport
GO:0006974 - cellular response to DNA damage stimulus
GO:0046718 - viral entry into host cell
GO:0034220 - ion transmembrane transport
GO:0046813 - receptor-mediated virion attachment to host cell
Note(s): Note(s): ...[more].
Reference(s): [1] Aich P., et al., 2012
[2] Batchelor E., et al., 2005
[3] Beher MG., et al., 1981
[4] Benz R., et al., 1989
[5] Bergstrom LC., et al., 1998
[6] Biro I., et al., 2010
[7] Bishop ND., et al., 1996
[8] Bowrin V., et al., 1994
[9] Capobianco JO., et al., 1994
[10] Castillo-Keller M., et al., 2006
[11] Catron KM., et al., 1987
[12] Chang CF., et al., 1985
[13] Chen S., et al., 2004
[14] Click EM., et al., 1989
[15] Darcan C., et al., 2003
[16] Delcour AH., et al., 1991
[17] Diedrich DL., et al., 1982
[18] Ferrario M., et al., 1995
[19] Forst S., et al., 1988
[20] Fralick JA., et al., 1982
[21] Gauthier MJ., et al., 1992
[22] Gehring KB., et al., 1989
[23] Ghai I., et al., 2017
[24] Gokce I., et al., 1997
[25] Head CG., et al., 1998
[26] Heller KB., et al., 1981
[27] Heyde M., et al., 2000
[28] Hikita C., et al., null
[29] Ikenaka K., et al., 1986
[30] Iyer R., et al., 1997
[31] Johansen J., et al., 2006
[32] Jung S., et al., 2020
[33] Kaeriyama M., et al., 2006
[34] Koga-Ban Y., et al., 1983
[35] Kojima S., et al., 2014
[36] Kumar A., et al., 2010
[37] Lakey JH., et al., 1991
[38] Lan CY., et al., 1998
[39] Le Dain AC., et al., 1996
[40] Lin X., et al., 2012
[41] Lin XM., et al., 2008
[42] Liu N., et al., 1997
[43] Liu N., et al., 1998
[44] Liu N., et al., 1998
[45] Liu N., et al., 2000
[46] Liu X., et al., 1998
[47] Macdonald AG., et al., 1999
[48] Mahendran KR., et al., 2010
[49] Maruthamuthu MK., et al., 2018
[50] Matsubara M., et al., 1999
[51] Matsuyama S., et al., 1984
[52] Misra R. 1993
[53] Misra R., et al., 1988
[54] Misra R., et al., 1988
[55] Mizuno T., et al., 1983
[56] Mizuno T., et al., 1986
[57] Mizuno T., et al., 1990
[58] Mobasheri H., et al., 2002
[59] Nikaido H., et al., 1984
[60] Nogami T., et al., 1985
[61] Ozawa Y., et al., 1987
[62] Ozawa Y., et al., 1983
[63] Pongprayoon P. 2014
[64] Ried G., et al., 1990
[65] Rocque WJ., et al., 1990
[66] Rocque WJ., et al., 1989
[67] Sallmann FR., et al., 1999
[68] Samuel Raj V., et al., 2002
[69] Schnaitman CA., et al., 1984
[70] Shrivastava R., et al., 2017
[71] Takayanagi K., et al., 1992
[72] Thomas AD., et al., 1992
[73] Todt JC., et al., 1992
[74] Vakharia H., et al., 1996
[75] Wang X., et al., 2021
[76] Xiong X., et al., 1996
[77] Xu Z., et al., 1999
[78] Yu F., et al., 1982
[79] Zhang DF., et al., 2008
[80] Zhang DF., et al., 2018
External database links:  
ALPHAFOLD:
 P06996
DIP:
 DIP-10397N
ECOCYC:
 EG10670-MONOMER
ECOLIWIKI:
 b2215
INTERPRO:
 IPR001702
INTERPRO:
 IPR023614
INTERPRO:
 IPR013793
INTERPRO:
 IPR001897
MINT:
 P06996
MODBASE:
 P06996
PDB:
 2J4U
PDB:
 2ZLE
PDB:
 4A8D
PDB:
 2J1N
PFAM:
 PF00267
PRIDE:
 P06996
PRINTS:
 PR00183
PRINTS:
 PR00182
PRODB:
 PRO_000023451
PROSITE:
 PS00576
REFSEQ:
 NP_416719
SMR:
 P06996
SWISSMODEL:
 P06996
UNIPROT:
 P06996


Operon      
Name: ompC         
Operon arrangement:
Transcription unit        Promoter
ompC
ompC
ompC


Transcriptional Regulation      
Display Regulation             
Activated by: OmpR, CpxR, EnvY
Repressed by: YjjQ, IHF, Lrp


Regulation by small RNA    
  Display Regulation
small RNA malH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter apbEp1 2311594 reverse nd [COMP-AINF] [81]
  promoter TSS_2484 2311836 reverse nd [RS-EPT-CBR] [82]
  promoter TSS_2485 2312187 reverse nd [RS-EPT-CBR] [82]
  promoter TSS_2486 2312511 forward nd [RS-EPT-CBR] [82]
  promoter TSS_2487 2312654 forward nd [RS-EPT-CBR] [82]
  promoter TSS_2488 2312657 reverse nd [RS-EPT-CBR] [82]


Evidence    

 [COMP-AINF] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates


Reference(s)    

 [1] Aich P., Patra M., Chatterjee AK., Roy SS., Basu T., 2012, Calcium chloride made E. coli competent for uptake of extraneous DNA through overproduction of OmpC protein., Protein J 31(5):366-73

 [2] Batchelor E., Walthers D., Kenney LJ., Goulian M., 2005, The Escherichia coli CpxA-CpxR envelope stress response system regulates expression of the porins ompF and ompC., J Bacteriol 187(16):5723-31

 [3] Beher MG., Pugsley AP., 1981, Coliphage which requires either the LamB protein or the OmpC protein for adsorption to Escherichia coli K-12., J Virol 38(1):372-5

 [4] Benz R., Schmid A., Van der Ley P., Tommassen J., 1989, Molecular basis of porin selectivity: membrane experiments with OmpC-PhoE and OmpF-PhoE hybrid proteins of Escherichia coli K-12., Biochim Biophys Acta 981(1):8-14

 [5] Bergstrom LC., Qin L., Harlocker SL., Egger LA., Inouye M., 1998, Hierarchical and co-operative binding of OmpR to a fusion construct containing the ompC and ompF upstream regulatory sequences of Escherichia coli., Genes Cells 3(12):777-88

 [6] Biro I., Pezeshki S., Weingart H., Winterhalter M., Kleinekathofer U., 2010, Comparing the temperature-dependent conductance of the two structurally similar E. coli porins OmpC and OmpF., Biophys J 98(9):1830-9

 [7] Bishop ND., Lea EJ., Mobasheri H., Spiro S., 1996, Altered voltage sensitivity of mutant OmpC porin channels., FEBS Lett 379(3):295-8

 [8] Bowrin V., Brissette R., Tsung K., Inouye M., 1994, The alpha subunit of RNA polymerase specifically inhibits expression of the porin genes ompF and ompC in vivo and in vitro in Escherichia coli., FEMS Microbiol Lett 115(1):1-6

 [9] Capobianco JO., Goldman RC., 1994, Macrolide transport in Escherichia coli strains having normal and altered OmpC and/or OmpF porins., Int J Antimicrob Agents 4(3):183-9

 [10] Castillo-Keller M., Vuong P., Misra R., 2006, Novel mechanism of Escherichia coli porin regulation., J Bacteriol 188(2):576-86

 [11] Catron KM., Schnaitman CA., 1987, Export of protein in Escherichia coli: a novel mutation in ompC affects expression of other major outer membrane proteins., J Bacteriol 169(9):4327-34

 [12] Chang CF., Mizushima S., Glaeser RM., 1985, Projected structure of the pore-forming OmpC protein from Escherichia coli outer membrane., Biophys J 47(5):629-39

 [13] Chen S., Zhang A., Blyn LB., Storz G., 2004, MicC, a second small-RNA regulator of Omp protein expression in Escherichia coli., J Bacteriol 186(20):6689-97

 [14] Click EM., Schnaitman CA., 1989, Export-defective lamB protein is a target for translational control caused by ompC porin overexpression., J Bacteriol 171(1):616-9

 [15] Darcan C., Ozkanca R., Flint KP., 2003, Survival of nonspecific porin-deficient mutants of Escherichia coli in black sea water., Lett Appl Microbiol 37(5):380-5

 [16] Delcour AH., Adler J., Kung C., 1991, A single amino acid substitution alters conductance and gating of OmpC porin of Escherichia coli., J Membr Biol 119(3):267-75

 [17] Diedrich DL., Fralick JA., 1982, Relationship between the OmpC and LamB proteins of Escherichia coli and its influence on the protein mass of the outer membrane., J Bacteriol 149(1):156-60

 [18] Ferrario M., Ernsting BR., Borst DW., Wiese DE., Blumenthal RM., Matthews RG., 1995, The leucine-responsive regulatory protein of Escherichia coli negatively regulates transcription of ompC and micF and positively regulates translation of ompF., J Bacteriol 177(1):103-13

 [19] Forst S., Delgado J., Ramakrishnan G., Inouye M., 1988, Regulation of ompC and ompF expression in Escherichia coli in the absence of envZ., J Bacteriol 170(11):5080-5

 [20] Fralick JA., Diedrich DL., 1982, Studies on the expression of outer membrane protein 2 in escherichia coli., Mol Gen Genet 188(1):139-42

 [21] Gauthier MJ., Benson SA., Flatau GN., Clement RL., Breittmayer VA., Munro PM., 1992, OmpC and OmpF porins influence viability and culturability of Escherichia coli cells incubated in seawater., Microb Releases 1(1):47-50

 [22] Gehring KB., Nikaido H., 1989, Existence and purification of porin heterotrimers of Escherichia coli K12 OmpC, OmpF, and PhoE proteins., J Biol Chem 264(5):2810-5

 [23] Ghai I., Winterhalter M., Wagner R., 2017, Probing transport of charged β-lactamase inhibitors through OmpC, a membrane channel from E. coli., Biochem Biophys Res Commun 484(1):51-55

 [24] Gokce I., Bainbridge G., Lakey JH., 1997, Stabilising and destabilising modifications of cysteines in the E. coli outer membrane porin protein OmpC., FEBS Lett 411(2-3):201-5

 [25] Head CG., Tardy A., Kenney LJ., 1998, Relative binding affinities of OmpR and OmpR-phosphate at the ompF and ompC regulatory sites., J Mol Biol 281(5):857-70

 [26] Heller KB., Wilson TH., 1981, Selectivity of the Escherichia coli outer membrane porins ompC and ompF., FEBS Lett 129(2):253-5

 [27] Heyde M., Laloi P., Portalier R., 2000, Involvement of carbon source and acetyl phosphate in the external-pH-dependent expression of porin genes in Escherichia coli., J Bacteriol 182(1):198-202

 [28] Hikita C., Satake Y., Yamada H., Mizuno T., Mizushima S., null, Structural and functional characterization of the OmpF and OmpC porins of the Escherichia coli outer membrane: studies involving chimeric proteins., Res Microbiol 140(3):177-90

 [29] Ikenaka K., Ramakrishnan G., Tsung K., Inouye M., 1986, Regulation of the ompC gene of Escherichia coli. Involvement of three tandem promoters., J Biol Chem 261(20):9316-20

 [30] Iyer R., Delcour AH., 1997, Complex inhibition of OmpF and OmpC bacterial porins by polyamines., J Biol Chem 272(30):18595-601

 [31] Johansen J., Rasmussen AA., Overgaard M., Valentin-Hansen P., 2006, Conserved small non-coding RNAs that belong to the sigmaE regulon: role in down-regulation of outer membrane proteins., J Mol Biol 364(1):1-8

 [32] Jung S., Bader V., Natriashvili A., Koch HG., Winklhofer KF., Tatzelt J., 2020, SecY-mediated quality control prevents the translocation of non-gated porins., Sci Rep 10(1):16347

 [33] Kaeriyama M., Machida K., Kitakaze A., Wang H., Lao Q., Fukamachi T., Saito H., Kobayashi H., 2006, OmpC and OmpF are required for growth under hyperosmotic stress above pH 8 in Escherichia coli., Lett Appl Microbiol 42(3):195-201

 [34] Koga-Ban Y., Mutoh N., Inokuchi K., Mizushima S., 1983, Mutation causing overproduction of outer membrane protein OmpF and suppression of OmpC synthesis in Escherichia coli., J Bacteriol 155(3):1110-5

 [35] Kojima S., Nikaido H., 2014, High salt concentrations increase permeability through OmpC channels of Escherichia coli., J Biol Chem 289(38):26464-73

 [36] Kumar A., Hajjar E., Ruggerone P., Ceccarelli M., 2010, Structural and dynamical properties of the porins OmpF and OmpC: insights from molecular simulations., J Phys Condens Matter 22(45):454125

 [37] Lakey JH., Lea EJ., Pattus F., 1991, ompC mutants which allow growth on maltodextrins show increased channel size and greater voltage sensitivity., FEBS Lett 278(1):31-4

 [38] Lan CY., Igo MM., 1998, Differential expression of the OmpF and OmpC porin proteins in Escherichia coli K-12 depends upon the level of active OmpR., J Bacteriol 180(1):171-4

 [39] Le Dain AC., Hase CC., Tommassen J., Martinac B., 1996, Porins of Escherichia coli: unidirectional gating by pressure., EMBO J 15(14):3524-8

 [40] Lin X., Wang C., Guo C., Tian Y., Li H., Peng X., 2012, Differential regulation of OmpC and OmpF by AtpB in Escherichia coli exposed to nalidixic acid and chlortetracycline., J Proteomics 75(18):5898-910

 [41] Lin XM., Li H., Wang C., Peng XX., 2008, Proteomic analysis of nalidixic acid resistance in Escherichia coli: identification and functional characterization of OM proteins., J Proteome Res 7(6):2399-405

 [42] Liu N., Benedik MJ., Delcour AH., 1997, Disruption of polyamine modulation by a single amino acid substitution on the L3 loop of the OmpC porin channel., Biochim Biophys Acta 1326(2):201-12

 [43] Liu N., Delcour AH., 1998, Inhibitory effect of acidic pH on OmpC porin: wild-type and mutant studies., FEBS Lett 434(1-2):160-4

 [44] Liu N., Delcour AH., 1998, The spontaneous gating activity of OmpC porin is affected by mutations of a putative hydrogen bond network or of a salt bridge between the L3 loop and the barrel., Protein Eng 11(9):797-802

 [45] Liu N., Samartzidou H., Lee KW., Briggs JM., Delcour AH., 2000, Effects of pore mutations and permeant ion concentration on the spontaneous gating activity of OmpC porin., Protein Eng 13(7):491-500

 [46] Liu X., Ferenci T., 1998, Regulation of porin-mediated outer membrane permeability by nutrient limitation in Escherichia coli., J Bacteriol 180(15):3917-22

 [47] Macdonald AG., Martinac B., 1999, Effect of high hydrostatic pressure on the porin OmpC from Escherichia coli., FEMS Microbiol Lett 173(2):327-34

 [48] Mahendran KR., Kreir M., Weingart H., Fertig N., Winterhalter M., 2010, Permeation of antibiotics through Escherichia coli OmpF and OmpC porins: screening for influx on a single-molecule level., J Biomol Screen 15(3):302-7

 [49] Maruthamuthu MK., Selvamani V., Nadarajan SP., Yun H., Oh YK., Eom GT., Hong SH., 2018, Manganese and cobalt recovery by surface display of metal binding peptide on various loops of OmpC in Escherichia coli., J Ind Microbiol Biotechnol 45(1):31-41

 [50] Matsubara M., Mizuno T., 1999, EnvZ-independent phosphotransfer signaling pathway of the OmpR-mediated osmoregulatory expression of OmpC and OmpF in Escherichia coli., Biosci Biotechnol Biochem 63(2):408-14

 [51] Matsuyama S., Inokuchi K., Mizushima S., 1984, Promoter exchange between ompF and ompC, genes for osmoregulated major outer membrane proteins of Escherichia coli K-12., J Bacteriol 158(3):1041-7

 [52] Misra R., 1993, A novel ompC mutation of Escherichia coli K-12 that reduces OmpC and OmpF levels in the outer membrane., Mol Microbiol 10(5):1029-35

 [53] Misra R., Benson SA., 1988, Genetic identification of the pore domain of the OmpC porin of Escherichia coli K-12., J Bacteriol 170(8):3611-7

 [54] Misra R., Benson SA., 1988, Isolation and characterization of OmpC porin mutants with altered pore properties., J Bacteriol 170(2):528-33

 [55] Mizuno T., Chou MY., Inouye M., 1983, DNA sequence of the promoter region of the ompC gene and the amino acid sequence of the signal peptide of pro-OmpC protein of Escherichia coli., FEBS Lett 151(1):159-64

 [56] Mizuno T., Mizushima S., 1986, Characterization by deletion and localized mutagenesis in vitro of the promoter region of the Escherichia coli ompC gene and importance of the upstream DNA domain in positive regulation by the OmpR protein., J Bacteriol 168(1):86-95

 [57] Mizuno T., Shinkai A., Matsui K., Mizushima S., 1990, Osmoregulatory expression of porin genes in Escherichia coli: a comparative study on strains B and K-12., FEMS Microbiol Lett 56(3):289-93

 [58] Mobasheri H., Lea EJ., 2002, Biophysics of gating phenomena in voltage-dependent OmpC mutant porin channels (R74C and R37C) of Escherichia coli outer membranes., Eur Biophys J 31(5):389-99

 [59] Nikaido H., Wu HC., 1984, Amino acid sequence homology among the major outer membrane proteins of Escherichia coli., Proc Natl Acad Sci U S A 81(4):1048-52

 [60] Nogami T., Mizuno T., Mizushima S., 1985, Construction of a series of ompF-ompC chimeric genes by in vivo homologous recombination in Escherichia coli and characterization of the translational products., J Bacteriol 164(2):797-801

 [61] Ozawa Y., Mizuno T., Mizushima S., 1987, Roles of the Pribnow box in positive regulation of the ompC and ompF genes in Escherichia coli., J Bacteriol 169(3):1331-4

 [62] Ozawa Y., Mizushima S., 1983, Regulation of outer membrane porin protein synthesis in Escherichia coli K-12: ompF regulates the expression of ompC., J Bacteriol 154(2):669-75

 [63] Pongprayoon P., 2014, How do the protonation states of E296 and D312 in OmpF and D299 and D315 in homologous OmpC affect protein structure and dynamics? Simulation studies., Comput Biol Chem 53PB:226-234

 [64] Ried G., Hindennach I., Henning U., 1990, Role of lipopolysaccharide in assembly of Escherichia coli outer membrane proteins OmpA, OmpC, and OmpF., J Bacteriol 172(10):6048-53

 [65] Rocque WJ., McGroarty EJ., 1990, Structure and function of an OmpC deletion mutant porin from Escherichia coli K-12., Biochemistry 29(22):5344-51

 [66] Rocque WJ., McGroarty EJ., 1989, Isolation and preliminary characterization of wild-type OmpC porin dimers from Escherichia coli K-12., Biochemistry 28(9):3738-43

 [67] Sallmann FR., Baveye-Descamps S., Pattus F., Salmon V., Branza N., Spik G., Legrand D., 1999, Porins OmpC and PhoE of Escherichia coli as specific cell-surface targets of human lactoferrin. Binding characteristics and biological effects., J Biol Chem 274(23):16107-14

 [68] Samuel Raj V., Full C., Yoshida M., Sakata K., Kashiwagi K., Ishihama A., Igarashi K., 2002, Decrease in cell viability in an RMF, sigma(38), and OmpC triple mutant of Escherichia coli., Biochem Biophys Res Commun 299(2):252-7

 [69] Schnaitman CA., McDonald GA., 1984, Regulation of outer membrane protein synthesis in Escherichia coli K-12: deletion of ompC affects expression of the OmpF protein., J Bacteriol 159(2):555-63

 [70] Shrivastava R., Jiang X., Chng SS., 2017, Outer membrane lipid homeostasis via retrograde phospholipid transport in Escherichia coli., Mol Microbiol 106(3):395-408

 [71] Takayanagi K., Mizuno T., 1992, Activation of the osmoregulated ompF and ompC genes by the OmpR protein in Escherichia coli: a study involving chimeric promoters., J Biochem 112(1):1-6

 [72] Thomas AD., Booth IR., 1992, The regulation of expression of the porin gene ompC by acid pH., J Gen Microbiol 138(9):1829-35

 [73] Todt JC., McGroarty EJ., 1992, Acid pH decreases OmpF and OmpC channel size in vivo., Biochem Biophys Res Commun 189(3):1498-502

 [74] Vakharia H., Misra R., 1996, A genetic approach for analysing surface-exposed regions of the OmpC protein of Escherichia coli K-12., Mol Microbiol 19(4):881-9

 [75] Wang X., Peterson JH., Bernstein HD., 2021, Bacterial Outer Membrane Proteins Are Targeted to the Bam Complex by Two Parallel Mechanisms., mBio 12(3)

 [76] Xiong X., Deeter JN., Misra R., 1996, Assembly-defective OmpC mutants of Escherichia coli K-12., J Bacteriol 178(4):1213-5

 [77] Xu Z., Lee SY., 1999, Display of polyhistidine peptides on the Escherichia coli cell surface by using outer membrane protein C as an anchoring motif., Appl Environ Microbiol 65(11):5142-7

 [78] Yu F., Mizushima S., 1982, Roles of lipopolysaccharide and outer membrane protein OmpC of Escherichia coli K-12 in the receptor function for bacteriophage T4., J Bacteriol 151(2):718-22

 [79] Zhang DF., Jiang B., Xiang ZM., Wang SY., 2008, Functional characterisation of altered outer membrane proteins for tetracycline resistance in Escherichia coli., Int J Antimicrob Agents 32(4):315-9

 [80] Zhang DF., Ye JZ., Dai HH., Lin XM., Li H., Peng XX., 2018, Identification of ethanol tolerant outer membrane proteome reveals OmpC-dependent mechanism in a manner of EnvZ/OmpR regulation in Escherichia coli., J Proteomics 179:92-99

 [81] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [82] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

RegulonDB